PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G25140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 636aa    MW: 71656 Da    PI: 5.466
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G25140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.32.6e-1132626342374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL++cA+a + +d+++ ++lL+++++++s +gd+ qRla++f++AL+arla+++s++y++l++++ts   + + l+a+kl++ ++P+ k+s+
  ORUFI04G25140.1 262 TTLLIHCAQAAAIDDHRNSNELLKQIRQRSSAYGDAGQRLAHCFANALEARLAGTGSNIYRSLAAKRTS---VYDILNAFKLYVTACPFKKISN 352
                      689**************************************************************9999...9********************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                      +   +aIl+a +g +r+Hi+D++i++G+QWp ++q +++Rp+gpps+RiTgv+ p++g   ++ +e+tg+rL+++A+ ++vpfe+++ +a +++
  ORUFI04G25140.1 353 FFSIEAILNASKGMTRLHIVDYGIQYGFQWPIFFQRISKRPGGPPSVRITGVDLPQPGfrPAQLIEATGRRLHDYARMFNVPFEYHA-IAAKWD 445
                      *********************************************************9*999*************************.799*** PP

             GRAS 188 dleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                      ++++e+L++++  +E l+Vn+ +++ +++de v+ +s+r +vLk++++++P+++++   +  +n++ F++rf eal yys+lfd+le++++r +
  ORUFI04G25140.1 446 TIRVEDLKIDKdkDELLVVNCLFRMRNMMDEMVTDDSPRMQVLKTIRKMNPNLFIHGVVNGTYNAPFFVTRFKEALFYYSSLFDMLETTASRVD 539
                      *********9999********************************************************************************* PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      e+r  +Er l+gre+ nvvaceg+er+er et+++W+ r  +aGFk++pl+++++k+a++ ++k + + + v+e+++++++gWk+r ++++SaW
  ORUFI04G25140.1 540 ENRLLIERDLFGREALNVVACEGTERVERPETYKQWQVRNIRAGFKQLPLNQETVKKARYKVKKSYHRDFLVDEDNKWMLQGWKGRIIFALSAW 633
                      ******************************************************************999************************* PP

             GRAS 374 r 374
                      +
  ORUFI04G25140.1 634 E 634
                      5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.547235614IPR005202Transcription factor GRAS
PfamPF035149.1E-111262634IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MLDSGSYDDV DYGDLFSIPN PPAPHLLNFP LQFFPSNGFI SSADDSHRSP AGMFGSTPSP  60
TSTTTELENS EDLSESADDA VLAYINQFLL EDEEDESCPG TITSVEDSAL LAVEKPFVDI  120
LTASQEACQE NSWIDSCCDF TGNGGLLDTF TTTHAACQPA PCEFEKEKGE CAVHKGRKNP  180
HDDCLLFEEE SRRSKQLAVS EEETVREMFD KVLLCNGECE LRAPLPAEAR NCGVYVKGSG  240
NKRGRKKGKS GASAEDDAVD LTTLLIHCAQ AAAIDDHRNS NELLKQIRQR SSAYGDAGQR  300
LAHCFANALE ARLAGTGSNI YRSLAAKRTS VYDILNAFKL YVTACPFKKI SNFFSIEAIL  360
NASKGMTRLH IVDYGIQYGF QWPIFFQRIS KRPGGPPSVR ITGVDLPQPG FRPAQLIEAT  420
GRRLHDYARM FNVPFEYHAI AAKWDTIRVE DLKIDKDKDE LLVVNCLFRM RNMMDEMVTD  480
DSPRMQVLKT IRKMNPNLFI HGVVNGTYNA PFFVTRFKEA LFYYSSLFDM LETTASRVDE  540
NRLLIERDLF GREALNVVAC EGTERVERPE TYKQWQVRNI RAGFKQLPLN QETVKKARYK  600
VKKSYHRDFL VDEDNKWMLQ GWKGRIIFAL SAWEPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-492656338374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6629810.0AL662981.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0086O06, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637021.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE581e-166SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0E0H5C80.0A0A0E0H5C8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PDD20.0A0A0E0PDD2_ORYRU; Uncharacterized protein
TrEMBLQ7XLZ10.0Q7XLZ1_ORYSJ;
STRINGLOC_Os04g50060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-155SCARECROW-like 14